Anti AMPH pAb (ATL-HPA019829 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019829-25

Protein Description: amphiphysin
Gene Name: AMPH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021314: 99%, ENSRNOG00000059510: 99%
Entrez Gene ID: 273
Uniprot ID: P49418
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRL
• Gene Sequence: PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDLATYKGLFPENFTRRL
• Gene ID - Mouse: ENSMUSG00000021314
• Gene ID - Rat: ENSRNOG00000059510
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AMPH pAb (ATL-HPA019829 w/enhanced validation) – 3 Found

Bedri, Sahl Khalid; Nilsson, Ola B; Fink, Katharina; Månberg, Anna; Hamsten, Carl; Ayoglu, Burcu; Manouchehrinia, Ali; Nilsson, Peter; Olsson, Tomas; Hillert, Jan; Grönlund, Hans; Glaser, Anna. Plasma protein profiling reveals candidate biomarkers for multiple sclerosis treatment. Plos One. 14(5):e0217208. 

Bergström, Sofia; Remnestål, Julia; Yousef, Jamil; Olofsson, Jennie; Markaki, Ioanna; Carvalho, Stephanie; Corvol, Jean-Christophe; Kultima, Kim; Kilander, Lena; Löwenmark, Malin; Ingelsson, Martin; Blennow, Kaj; Zetterberg, Henrik; Nellgård, Bengt; Brosseron, Frederic; Heneka, Michael T; Bosch, Beatriz; Sanchez-Valle, Raquel; Månberg, Anna; Svenningsson, Per; Nilsson, Peter. Multi-cohort profiling reveals elevated CSF levels of brain-enriched proteins in Alzheimer's disease. Annals Of Clinical And Translational Neurology. 2021;8(7):1456-1470. 

Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79.