Anti AMPD3 pAb (ATL-HPA038662)

Atlas Antibodies

Catalog No.:
ATL-HPA038662-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adenosine monophosphate deaminase 3
Gene Name: AMPD3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005686: 89%, ENSRNOG00000018262: 89%
Entrez Gene ID: 272
Uniprot ID: Q01432
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDLETYTVDMSHILALITDGPTKTYCHRRLNFLES
Gene Sequence PYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDLETYTVDMSHILALITDGPTKTYCHRRLNFLES
Gene ID - Mouse ENSMUSG00000005686
Gene ID - Rat ENSRNOG00000018262
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMPD3 pAb (ATL-HPA038662)
Datasheet Anti AMPD3 pAb (ATL-HPA038662) Datasheet (External Link)
Vendor Page Anti AMPD3 pAb (ATL-HPA038662) at Atlas Antibodies

Documents & Links for Anti AMPD3 pAb (ATL-HPA038662)
Datasheet Anti AMPD3 pAb (ATL-HPA038662) Datasheet (External Link)
Vendor Page Anti AMPD3 pAb (ATL-HPA038662)