Anti AMPD2 pAb (ATL-HPA050590)

Atlas Antibodies

Catalog No.:
ATL-HPA050590-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: adenosine monophosphate deaminase 2
Gene Name: AMPD2
Alternative Gene Name: SPG63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027889: 59%, ENSRNOG00000019240: 60%
Entrez Gene ID: 271
Uniprot ID: Q01433
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRKGLDVAEPGPSRCRSDSPAVAAVVPAMASYPSGSGKPKAKYPFKKRASLQASTAAPEARGGLGAPPLQSARSLPGPAPCLKHFPL
Gene Sequence RRKGLDVAEPGPSRCRSDSPAVAAVVPAMASYPSGSGKPKAKYPFKKRASLQASTAAPEARGGLGAPPLQSARSLPGPAPCLKHFPL
Gene ID - Mouse ENSMUSG00000027889
Gene ID - Rat ENSRNOG00000019240
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMPD2 pAb (ATL-HPA050590)
Datasheet Anti AMPD2 pAb (ATL-HPA050590) Datasheet (External Link)
Vendor Page Anti AMPD2 pAb (ATL-HPA050590) at Atlas Antibodies

Documents & Links for Anti AMPD2 pAb (ATL-HPA050590)
Datasheet Anti AMPD2 pAb (ATL-HPA050590) Datasheet (External Link)
Vendor Page Anti AMPD2 pAb (ATL-HPA050590)