Anti AMPD2 pAb (ATL-HPA027137)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027137-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: AMPD2
Alternative Gene Name: SPG63
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027889: 98%, ENSRNOG00000019240: 98%
Entrez Gene ID: 271
Uniprot ID: Q01433
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSADAP |
Gene Sequence | VLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSADAP |
Gene ID - Mouse | ENSMUSG00000027889 |
Gene ID - Rat | ENSRNOG00000019240 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AMPD2 pAb (ATL-HPA027137) | |
Datasheet | Anti AMPD2 pAb (ATL-HPA027137) Datasheet (External Link) |
Vendor Page | Anti AMPD2 pAb (ATL-HPA027137) at Atlas Antibodies |
Documents & Links for Anti AMPD2 pAb (ATL-HPA027137) | |
Datasheet | Anti AMPD2 pAb (ATL-HPA027137) Datasheet (External Link) |
Vendor Page | Anti AMPD2 pAb (ATL-HPA027137) |