Anti AMPD1 pAb (ATL-HPA026478)

Atlas Antibodies

Catalog No.:
ATL-HPA026478-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adenosine monophosphate deaminase 1
Gene Name: AMPD1
Alternative Gene Name: MAD, MADA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070385: 92%, ENSRNOG00000018656: 92%
Entrez Gene ID: 270
Uniprot ID: P23109
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SETSSTKLSHIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEIVCKGLYRALCIREKYMQKSFQRFPKTPSKYLRNIDGEAWVANE
Gene Sequence SETSSTKLSHIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEIVCKGLYRALCIREKYMQKSFQRFPKTPSKYLRNIDGEAWVANE
Gene ID - Mouse ENSMUSG00000070385
Gene ID - Rat ENSRNOG00000018656
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMPD1 pAb (ATL-HPA026478)
Datasheet Anti AMPD1 pAb (ATL-HPA026478) Datasheet (External Link)
Vendor Page Anti AMPD1 pAb (ATL-HPA026478) at Atlas Antibodies

Documents & Links for Anti AMPD1 pAb (ATL-HPA026478)
Datasheet Anti AMPD1 pAb (ATL-HPA026478) Datasheet (External Link)
Vendor Page Anti AMPD1 pAb (ATL-HPA026478)