Anti AMOTL1 pAb (ATL-HPA001196)

Atlas Antibodies

Catalog No.:
ATL-HPA001196-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: angiomotin like 1
Gene Name: AMOTL1
Alternative Gene Name: JEAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013076: 82%, ENSRNOG00000008990: 32%
Entrez Gene ID: 154810
Uniprot ID: Q8IY63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETSALTVEATSSIREKVVEDPLCNFHSPNFLRISEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAIQHQATGSAGPAHPTNNFSSTENLTQEDPQMVYQSARQEPQGQEHQV
Gene Sequence SPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETSALTVEATSSIREKVVEDPLCNFHSPNFLRISEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAIQHQATGSAGPAHPTNNFSSTENLTQEDPQMVYQSARQEPQGQEHQV
Gene ID - Mouse ENSMUSG00000013076
Gene ID - Rat ENSRNOG00000008990
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMOTL1 pAb (ATL-HPA001196)
Datasheet Anti AMOTL1 pAb (ATL-HPA001196) Datasheet (External Link)
Vendor Page Anti AMOTL1 pAb (ATL-HPA001196) at Atlas Antibodies

Documents & Links for Anti AMOTL1 pAb (ATL-HPA001196)
Datasheet Anti AMOTL1 pAb (ATL-HPA001196) Datasheet (External Link)
Vendor Page Anti AMOTL1 pAb (ATL-HPA001196)
Citations for Anti AMOTL1 pAb (ATL-HPA001196) – 6 Found
Ragni, Chiara V; Diguet, Nicolas; Le Garrec, Jean-François; Novotova, Marta; Resende, Tatiana P; Pop, Sorin; Charon, Nicolas; Guillemot, Laurent; Kitasato, Lisa; Badouel, Caroline; Dufour, Alexandre; Olivo-Marin, Jean-Christophe; Trouvé, Alain; McNeill, Helen; Meilhac, Sigolène M. Amotl1 mediates sequestration of the Hippo effector Yap1 downstream of Fat4 to restrict heart growth. Nature Communications. 2017;8( 28239148):14582.  PubMed
Wei, Yiju; Yee, Patricia P; Liu, Zhijun; Zhang, Lei; Guo, Hui; Zheng, Haiyan; Anderson, Benjamin; Gulley, Melissa; Li, Wei. NEDD4L-mediated Merlin ubiquitination facilitates Hippo pathway activation. Embo Reports. 2020;21(12):e50642.  PubMed
Couderc, Christophe; Boin, Alizée; Fuhrmann, Laetitia; Vincent-Salomon, Anne; Mandati, Vinay; Kieffer, Yann; Mechta-Grigoriou, Fatima; Del Maestro, Laurence; Chavrier, Philippe; Vallerand, David; Brito, Isabelle; Dubois, Thierry; De Koning, Leanne; Bouvard, Daniel; Louvard, Daniel; Gautreau, Alexis; Lallemand, Dominique. AMOTL1 Promotes Breast Cancer Progression and Is Antagonized by Merlin. Neoplasia (New York, N.y.). 2016;18(1):10-24.  PubMed
Vargas, Rebecca E; Duong, Vy Thuy; Han, Han; Ta, Albert Paul; Chen, Yuxuan; Zhao, Shiji; Yang, Bing; Seo, Gayoung; Chuc, Kimberly; Oh, Sunwoo; El Ali, Amal; Razorenova, Olga V; Chen, Junjie; Luo, Ray; Li, Xu; Wang, Wenqi. Elucidation of WW domain ligand binding specificities in the Hippo pathway reveals STXBP4 as YAP inhibitor. The Embo Journal. 2020;39(1):e102406.  PubMed
Brunner, Patrizia; Hastar, Nurcan; Kaehler, Christian; Burdzinski, Wiktor; Jatzlau, Jerome; Knaus, Petra. AMOT130 drives BMP-SMAD signaling at the apical membrane in polarized cells. Molecular Biology Of The Cell. 2020;31(2):118-130.  PubMed
Zhou, Yuhang; Zhang, Jinglin; Li, Hui; Huang, Tingting; Wong, Chi Chun; Wu, Feng; Wu, Man; Weng, Nuoqing; Liu, Liping; Cheng, Alfred S L; Yu, Jun; Wong, Nathalie; Lo, Kwok Wai; Tang, Patrick M K; Kang, Wei; To, Ka Fai. AMOTL1 enhances YAP1 stability and promotes YAP1-driven gastric oncogenesis. Oncogene. 2020;39(22):4375-4389.  PubMed