Anti AMOT pAb (ATL-HPA067853)

Atlas Antibodies

Catalog No.:
ATL-HPA067853-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: angiomotin
Gene Name: AMOT
Alternative Gene Name: KIAA1071
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041688: 89%, ENSRNOG00000007345: 88%
Entrez Gene ID: 154796
Uniprot ID: Q4VCS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPLSARNSQ
Gene Sequence PFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPLSARNSQ
Gene ID - Mouse ENSMUSG00000041688
Gene ID - Rat ENSRNOG00000007345
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMOT pAb (ATL-HPA067853)
Datasheet Anti AMOT pAb (ATL-HPA067853) Datasheet (External Link)
Vendor Page Anti AMOT pAb (ATL-HPA067853) at Atlas Antibodies

Documents & Links for Anti AMOT pAb (ATL-HPA067853)
Datasheet Anti AMOT pAb (ATL-HPA067853) Datasheet (External Link)
Vendor Page Anti AMOT pAb (ATL-HPA067853)