Anti AMN1 pAb (ATL-HPA062290)

Atlas Antibodies

Catalog No.:
ATL-HPA062290-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: antagonist of mitotic exit network 1 homolog
Gene Name: AMN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068250: 79%, ENSRNOG00000036917: 85%
Entrez Gene ID: 196394
Uniprot ID: Q8IY45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY
Gene Sequence LTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY
Gene ID - Mouse ENSMUSG00000068250
Gene ID - Rat ENSRNOG00000036917
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMN1 pAb (ATL-HPA062290)
Datasheet Anti AMN1 pAb (ATL-HPA062290) Datasheet (External Link)
Vendor Page Anti AMN1 pAb (ATL-HPA062290) at Atlas Antibodies

Documents & Links for Anti AMN1 pAb (ATL-HPA062290)
Datasheet Anti AMN1 pAb (ATL-HPA062290) Datasheet (External Link)
Vendor Page Anti AMN1 pAb (ATL-HPA062290)