Anti AMN pAb (ATL-HPA000817)

Atlas Antibodies

SKU: ATL-HPA000817-25

• 

Protein Description: amnion associated transmembrane protein
Gene Name: AMN
Alternative Gene Name: amnionless
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021278: 69%, ENSRNOG00000009050: 67%
Entrez Gene ID: 81693
Uniprot ID: Q9BXJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISAL
• Gene Sequence: VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISAL
• Gene ID - Mouse: ENSMUSG00000021278
• Gene ID - Rat: ENSRNOG00000009050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AMN pAb (ATL-HPA000817) – 2 Found

Udagawa, Tomohiro; Harita, Yutaka; Miura, Kenichiro; Mitsui, Jun; Ode, Koji L; Morishita, Shinichi; Urae, Seiya; Kanda, Shoichiro; Kajiho, Yuko; Tsurumi, Haruko; Ueda, Hiroki R; Tsuji, Shoji; Saito, Akihiko; Oka, Akira. Amnionless-mediated glycosylation is crucial for cell surface targeting of cubilin in renal and intestinal cells. Scientific Reports. 2018;8(1):2351. 

Galamb, Orsolya; Sipos, Ferenc; Spisák, Sándor; Galamb, Barnabás; Krenács, Tibor; Valcz, Gábor; Tulassay, Zsolt; Molnár, Béla. Potential biomarkers of colorectal adenoma-dysplasia-carcinoma progression: mRNA expression profiling and in situ protein detection on TMAs reveal 15 sequentially upregulated and 2 downregulated genes. Cellular Oncology : The Official Journal Of The International Society For Cellular Oncology. 31(1):19-29.