Anti AMH pAb (ATL-HPA066973)
Atlas Antibodies
- SKU:
- ATL-HPA066973-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: AMH
Alternative Gene Name: MIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035262: 66%, ENSRNOG00000019377: 67%
Entrez Gene ID: 268
Uniprot ID: P03971
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GEDSRLSTARLQALLFGDDHRCFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLT |
Gene Sequence | GEDSRLSTARLQALLFGDDHRCFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLT |
Gene ID - Mouse | ENSMUSG00000035262 |
Gene ID - Rat | ENSRNOG00000019377 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AMH pAb (ATL-HPA066973) | |
Datasheet | Anti AMH pAb (ATL-HPA066973) Datasheet (External Link) |
Vendor Page | Anti AMH pAb (ATL-HPA066973) at Atlas Antibodies |
Documents & Links for Anti AMH pAb (ATL-HPA066973) | |
Datasheet | Anti AMH pAb (ATL-HPA066973) Datasheet (External Link) |
Vendor Page | Anti AMH pAb (ATL-HPA066973) |