Anti AMH pAb (ATL-HPA066973)

Atlas Antibodies

Catalog No.:
ATL-HPA066973-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: anti-Mullerian hormone
Gene Name: AMH
Alternative Gene Name: MIS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035262: 66%, ENSRNOG00000019377: 67%
Entrez Gene ID: 268
Uniprot ID: P03971
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEDSRLSTARLQALLFGDDHRCFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLT
Gene Sequence GEDSRLSTARLQALLFGDDHRCFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLT
Gene ID - Mouse ENSMUSG00000035262
Gene ID - Rat ENSRNOG00000019377
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMH pAb (ATL-HPA066973)
Datasheet Anti AMH pAb (ATL-HPA066973) Datasheet (External Link)
Vendor Page Anti AMH pAb (ATL-HPA066973) at Atlas Antibodies

Documents & Links for Anti AMH pAb (ATL-HPA066973)
Datasheet Anti AMH pAb (ATL-HPA066973) Datasheet (External Link)
Vendor Page Anti AMH pAb (ATL-HPA066973)