Anti AMFR pAb (ATL-HPA029018)

Atlas Antibodies

Catalog No.:
ATL-HPA029018-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: autocrine motility factor receptor, E3 ubiquitin protein ligase
Gene Name: AMFR
Alternative Gene Name: gp78, RNF45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031751: 99%, ENSRNOG00000055446: 99%
Entrez Gene ID: 267
Uniprot ID: Q9UKV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPVAAAEGRPRLNQHNHFFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVP
Gene Sequence VPVAAAEGRPRLNQHNHFFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVP
Gene ID - Mouse ENSMUSG00000031751
Gene ID - Rat ENSRNOG00000055446
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMFR pAb (ATL-HPA029018)
Datasheet Anti AMFR pAb (ATL-HPA029018) Datasheet (External Link)
Vendor Page Anti AMFR pAb (ATL-HPA029018) at Atlas Antibodies

Documents & Links for Anti AMFR pAb (ATL-HPA029018)
Datasheet Anti AMFR pAb (ATL-HPA029018) Datasheet (External Link)
Vendor Page Anti AMFR pAb (ATL-HPA029018)
Citations for Anti AMFR pAb (ATL-HPA029018) – 1 Found
Qundos, Ulrika; Drobin, Kimi; Mattsson, Cecilia; Hong, Mun-Gwan; Sjöberg, Ronald; Forsström, Björn; Solomon, David; Uhlén, Mathias; Nilsson, Peter; Michaëlsson, Karl; Schwenk, Jochen M. Affinity proteomics discovers decreased levels of AMFR in plasma from Osteoporosis patients. Proteomics. Clinical Applications. 2016;10(6):681-90.  PubMed