Anti AMFR pAb (ATL-HPA029018)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029018-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: AMFR
Alternative Gene Name: gp78, RNF45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031751: 99%, ENSRNOG00000055446: 99%
Entrez Gene ID: 267
Uniprot ID: Q9UKV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VPVAAAEGRPRLNQHNHFFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVP |
Gene Sequence | VPVAAAEGRPRLNQHNHFFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVP |
Gene ID - Mouse | ENSMUSG00000031751 |
Gene ID - Rat | ENSRNOG00000055446 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AMFR pAb (ATL-HPA029018) | |
Datasheet | Anti AMFR pAb (ATL-HPA029018) Datasheet (External Link) |
Vendor Page | Anti AMFR pAb (ATL-HPA029018) at Atlas Antibodies |
Documents & Links for Anti AMFR pAb (ATL-HPA029018) | |
Datasheet | Anti AMFR pAb (ATL-HPA029018) Datasheet (External Link) |
Vendor Page | Anti AMFR pAb (ATL-HPA029018) |
Citations for Anti AMFR pAb (ATL-HPA029018) – 1 Found |
Qundos, Ulrika; Drobin, Kimi; Mattsson, Cecilia; Hong, Mun-Gwan; Sjöberg, Ronald; Forsström, Björn; Solomon, David; Uhlén, Mathias; Nilsson, Peter; Michaëlsson, Karl; Schwenk, Jochen M. Affinity proteomics discovers decreased levels of AMFR in plasma from Osteoporosis patients. Proteomics. Clinical Applications. 2016;10(6):681-90. PubMed |