Anti AMDHD2 pAb (ATL-HPA041321 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041321-25
  • Immunohistochemical staining of human adrenal gland, cerebral cortex, kidney and testis using Anti-AMDHD2 antibody HPA041321 (A) shows similar protein distribution across tissues to independent antibody HPA041184 (B).
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: amidohydrolase domain containing 2
Gene Name: AMDHD2
Alternative Gene Name: CGI-14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036820: 89%, ENSRNOG00000006460: 88%
Entrez Gene ID: 51005
Uniprot ID: Q9Y303
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTLVTSPPEVYHKVVPQIPVKSGGPHGAGVLGLHLEGPFISREKRGAHPEAHLRSFEADAFQDLLATYGPLDNVRIVTLAPELGRSHEVIRALTARGICVSLGHSVADLRAAEDAVWSG
Gene Sequence PTLVTSPPEVYHKVVPQIPVKSGGPHGAGVLGLHLEGPFISREKRGAHPEAHLRSFEADAFQDLLATYGPLDNVRIVTLAPELGRSHEVIRALTARGICVSLGHSVADLRAAEDAVWSG
Gene ID - Mouse ENSMUSG00000036820
Gene ID - Rat ENSRNOG00000006460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti AMDHD2 pAb (ATL-HPA041321 w/enhanced validation)
Datasheet Anti AMDHD2 pAb (ATL-HPA041321 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AMDHD2 pAb (ATL-HPA041321 w/enhanced validation)