Anti AMDHD1 pAb (ATL-HPA040149)

Atlas Antibodies

SKU:
ATL-HPA040149-25
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: amidohydrolase domain containing 1
Gene Name: AMDHD1
Alternative Gene Name: MGC35366
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015890: 98%, ENSRNOG00000005266: 98%
Entrez Gene ID: 144193
Uniprot ID: Q96NU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEGVIVALGSDFNPNAYCFSMPMVMHLACVNMRMSMPEALAAATINAAYALGKSHTHGSLEVGKQGDLIIINSSRWEHLIYQFG
Gene Sequence DEGVIVALGSDFNPNAYCFSMPMVMHLACVNMRMSMPEALAAATINAAYALGKSHTHGSLEVGKQGDLIIINSSRWEHLIYQFG
Gene ID - Mouse ENSMUSG00000015890
Gene ID - Rat ENSRNOG00000005266
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AMDHD1 pAb (ATL-HPA040149)
Datasheet Anti AMDHD1 pAb (ATL-HPA040149) Datasheet (External Link)
Vendor Page Anti AMDHD1 pAb (ATL-HPA040149) at Atlas Antibodies

Documents & Links for Anti AMDHD1 pAb (ATL-HPA040149)
Datasheet Anti AMDHD1 pAb (ATL-HPA040149) Datasheet (External Link)
Vendor Page Anti AMDHD1 pAb (ATL-HPA040149)