Anti AMD1 pAb (ATL-HPA029282)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029282-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AMD1
Alternative Gene Name: SAMDC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075232: 96%, ENSRNOG00000000585: 96%
Entrez Gene ID: 262
Uniprot ID: P17707
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSESSMFVSKRRFI |
Gene Sequence | FEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSESSMFVSKRRFI |
Gene ID - Mouse | ENSMUSG00000075232 |
Gene ID - Rat | ENSRNOG00000000585 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AMD1 pAb (ATL-HPA029282) | |
Datasheet | Anti AMD1 pAb (ATL-HPA029282) Datasheet (External Link) |
Vendor Page | Anti AMD1 pAb (ATL-HPA029282) at Atlas Antibodies |
Documents & Links for Anti AMD1 pAb (ATL-HPA029282) | |
Datasheet | Anti AMD1 pAb (ATL-HPA029282) Datasheet (External Link) |
Vendor Page | Anti AMD1 pAb (ATL-HPA029282) |