Anti AMD1 pAb (ATL-HPA029281)

Atlas Antibodies

SKU:
ATL-HPA029281-25
  • Immunohistochemical staining of human placenta shows distinct nuclear positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adenosylmethionine decarboxylase 1
Gene Name: AMD1
Alternative Gene Name: SAMDC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075232: 97%, ENSRNOG00000000585: 97%
Entrez Gene ID: 262
Uniprot ID: P17707
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYN
Gene Sequence TIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYN
Gene ID - Mouse ENSMUSG00000075232
Gene ID - Rat ENSRNOG00000000585
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AMD1 pAb (ATL-HPA029281)
Datasheet Anti AMD1 pAb (ATL-HPA029281) Datasheet (External Link)
Vendor Page Anti AMD1 pAb (ATL-HPA029281) at Atlas Antibodies

Documents & Links for Anti AMD1 pAb (ATL-HPA029281)
Datasheet Anti AMD1 pAb (ATL-HPA029281) Datasheet (External Link)
Vendor Page Anti AMD1 pAb (ATL-HPA029281)