Anti AMD1 pAb (ATL-HPA029281)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029281-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AMD1
Alternative Gene Name: SAMDC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075232: 97%, ENSRNOG00000000585: 97%
Entrez Gene ID: 262
Uniprot ID: P17707
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYN |
| Gene Sequence | TIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYN |
| Gene ID - Mouse | ENSMUSG00000075232 |
| Gene ID - Rat | ENSRNOG00000000585 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AMD1 pAb (ATL-HPA029281) | |
| Datasheet | Anti AMD1 pAb (ATL-HPA029281) Datasheet (External Link) |
| Vendor Page | Anti AMD1 pAb (ATL-HPA029281) at Atlas Antibodies |
| Documents & Links for Anti AMD1 pAb (ATL-HPA029281) | |
| Datasheet | Anti AMD1 pAb (ATL-HPA029281) Datasheet (External Link) |
| Vendor Page | Anti AMD1 pAb (ATL-HPA029281) |