Anti AMBP pAb (ATL-HPA075585)

Atlas Antibodies

Catalog No.:
ATL-HPA075585-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: alpha-1-microglobulin/bikunin precursor
Gene Name: AMBP
Alternative Gene Name: EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028356: 83%, ENSRNOG00000006889: 80%
Entrez Gene ID: 259
Uniprot ID: P02760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWN
Gene Sequence YGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWN
Gene ID - Mouse ENSMUSG00000028356
Gene ID - Rat ENSRNOG00000006889
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AMBP pAb (ATL-HPA075585)
Datasheet Anti AMBP pAb (ATL-HPA075585) Datasheet (External Link)
Vendor Page Anti AMBP pAb (ATL-HPA075585) at Atlas Antibodies

Documents & Links for Anti AMBP pAb (ATL-HPA075585)
Datasheet Anti AMBP pAb (ATL-HPA075585) Datasheet (External Link)
Vendor Page Anti AMBP pAb (ATL-HPA075585)