Anti AMBP pAb (ATL-HPA075585)

Atlas Antibodies

Catalog No.: ATL-HPA075585-100

Protein Description: alpha-1-microglobulin/bikunin precursor
Gene Name: AMBP
Alternative Gene Name: EDC1, HCP, HI30, IATIL, ITI, ITIL, ITILC, UTI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028356: 83%, ENSRNOG00000006889: 80%
Entrez Gene ID: 259
Uniprot ID: P02760
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWN
• Gene Sequence: YGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWN
• Gene ID - Mouse: ENSMUSG00000028356
• Gene ID - Rat: ENSRNOG00000006889
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.