Anti AMACR pAb (ATL-HPA019527 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019527-25

Protein Description: alpha-methylacyl-CoA racemase
Gene Name: AMACR
Alternative Gene Name: RACE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022244: 68%, ENSRNOG00000018662: 71%
Entrez Gene ID: 23600
Uniprot ID: Q9UHK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHTEEILEEFGFSREEIYQLNSDKIIESNKVKASL
• Gene Sequence: HNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHTEEILEEFGFSREEIYQLNSDKIIESNKVKASL
• Gene ID - Mouse: ENSMUSG00000022244
• Gene ID - Rat: ENSRNOG00000018662
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AMACR pAb (ATL-HPA019527 w/enhanced validation) – 1 Found

Yao, Jiwei; Wang, Yuan; Dai, Yifan; Liu, Chung Chiun. Bioconjugated, Single-Use Biosensor for the Detection of Biomarkers of Prostate Cancer. Acs Omega. 2018;3(6):6411-6418.