Anti ALYREF pAb (ATL-HPA061282)

Atlas Antibodies

Catalog No.:
ATL-HPA061282-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: Aly/REF export factor
Gene Name: ALYREF
Alternative Gene Name: ALY, ALY/REF, BEF, REF, THOC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025134: 100%, ENSRNOG00000036687: 100%
Entrez Gene ID: 10189
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVET
Gene Sequence GGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVET
Gene ID - Mouse ENSMUSG00000025134
Gene ID - Rat ENSRNOG00000036687
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALYREF pAb (ATL-HPA061282)
Datasheet Anti ALYREF pAb (ATL-HPA061282) Datasheet (External Link)
Vendor Page Anti ALYREF pAb (ATL-HPA061282) at Atlas Antibodies

Documents & Links for Anti ALYREF pAb (ATL-HPA061282)
Datasheet Anti ALYREF pAb (ATL-HPA061282) Datasheet (External Link)
Vendor Page Anti ALYREF pAb (ATL-HPA061282)