Anti ALX1 pAb (ATL-HPA018905)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018905-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ALX1
Alternative Gene Name: CART1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036602: 99%, ENSRNOG00000004390: 97%
Entrez Gene ID: 8092
Uniprot ID: Q15699
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSSSIAVL |
Gene Sequence | QIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSSSIAVL |
Gene ID - Mouse | ENSMUSG00000036602 |
Gene ID - Rat | ENSRNOG00000004390 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALX1 pAb (ATL-HPA018905) | |
Datasheet | Anti ALX1 pAb (ATL-HPA018905) Datasheet (External Link) |
Vendor Page | Anti ALX1 pAb (ATL-HPA018905) at Atlas Antibodies |
Documents & Links for Anti ALX1 pAb (ATL-HPA018905) | |
Datasheet | Anti ALX1 pAb (ATL-HPA018905) Datasheet (External Link) |
Vendor Page | Anti ALX1 pAb (ATL-HPA018905) |
Citations for Anti ALX1 pAb (ATL-HPA018905) – 1 Found |
Wang, Xiaoke; Bledsoe, Krista L; Graham, Rondell P; Asmann, Yan W; Viswanatha, David S; Lewis, Jean E; Lewis, Jason T; Chou, Margaret M; Yaszemski, Michael J; Jen, Jin; Westendorf, Jennifer J; Oliveira, André M. Recurrent PAX3-MAML3 fusion in biphenotypic sinonasal sarcoma. Nature Genetics. 2014;46(7):666-8. PubMed |