Anti ALX1 pAb (ATL-HPA018905)

Atlas Antibodies

Catalog No.:
ATL-HPA018905-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ALX homeobox 1
Gene Name: ALX1
Alternative Gene Name: CART1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036602: 99%, ENSRNOG00000004390: 97%
Entrez Gene ID: 8092
Uniprot ID: Q15699
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSSSIAVL
Gene Sequence QIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSSSIAVL
Gene ID - Mouse ENSMUSG00000036602
Gene ID - Rat ENSRNOG00000004390
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALX1 pAb (ATL-HPA018905)
Datasheet Anti ALX1 pAb (ATL-HPA018905) Datasheet (External Link)
Vendor Page Anti ALX1 pAb (ATL-HPA018905) at Atlas Antibodies

Documents & Links for Anti ALX1 pAb (ATL-HPA018905)
Datasheet Anti ALX1 pAb (ATL-HPA018905) Datasheet (External Link)
Vendor Page Anti ALX1 pAb (ATL-HPA018905)
Citations for Anti ALX1 pAb (ATL-HPA018905) – 1 Found
Wang, Xiaoke; Bledsoe, Krista L; Graham, Rondell P; Asmann, Yan W; Viswanatha, David S; Lewis, Jean E; Lewis, Jason T; Chou, Margaret M; Yaszemski, Michael J; Jen, Jin; Westendorf, Jennifer J; Oliveira, André M. Recurrent PAX3-MAML3 fusion in biphenotypic sinonasal sarcoma. Nature Genetics. 2014;46(7):666-8.  PubMed