Anti ALS2CR12 pAb (ATL-HPA035793)

Atlas Antibodies

SKU:
ATL-HPA035793-25
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 12
Gene Name: ALS2CR12
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047528: 67%, ENSRNOG00000024917: 73%
Entrez Gene ID: 130540
Uniprot ID: Q96Q35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNR
Gene Sequence HSARQEETNKSFYEVINVSPGYQLVRNREQISVTLGDEMFDRKKRWESEIPDKGRFSRTNIISDLEEQISELTAIIEQMNR
Gene ID - Mouse ENSMUSG00000047528
Gene ID - Rat ENSRNOG00000024917
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALS2CR12 pAb (ATL-HPA035793)
Datasheet Anti ALS2CR12 pAb (ATL-HPA035793) Datasheet (External Link)
Vendor Page Anti ALS2CR12 pAb (ATL-HPA035793) at Atlas Antibodies

Documents & Links for Anti ALS2CR12 pAb (ATL-HPA035793)
Datasheet Anti ALS2CR12 pAb (ATL-HPA035793) Datasheet (External Link)
Vendor Page Anti ALS2CR12 pAb (ATL-HPA035793)