Anti ALS2CL pAb (ATL-HPA048301)

Atlas Antibodies

Catalog No.:
ATL-HPA048301-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ALS2 C-terminal like
Gene Name: ALS2CL
Alternative Gene Name: DKFZp686I0110, FLJ36525, RN49018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044037: 91%, ENSRNOG00000033921: 95%
Entrez Gene ID: 259173
Uniprot ID: Q60I27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDPREKLEVLERTYGEIEGTVSRVLGREYKLPMDDLLPLLIYVVSRARIQHLGAEIHLIRDMMDPNHTGGLYDFLLTALES
Gene Sequence VDPREKLEVLERTYGEIEGTVSRVLGREYKLPMDDLLPLLIYVVSRARIQHLGAEIHLIRDMMDPNHTGGLYDFLLTALES
Gene ID - Mouse ENSMUSG00000044037
Gene ID - Rat ENSRNOG00000033921
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALS2CL pAb (ATL-HPA048301)
Datasheet Anti ALS2CL pAb (ATL-HPA048301) Datasheet (External Link)
Vendor Page Anti ALS2CL pAb (ATL-HPA048301) at Atlas Antibodies

Documents & Links for Anti ALS2CL pAb (ATL-HPA048301)
Datasheet Anti ALS2CL pAb (ATL-HPA048301) Datasheet (External Link)
Vendor Page Anti ALS2CL pAb (ATL-HPA048301)