Anti ALS2CL pAb (ATL-HPA048301)

Atlas Antibodies

Catalog No.: ATL-HPA048301-25

Protein Description: ALS2 C-terminal like
Gene Name: ALS2CL
Alternative Gene Name: DKFZp686I0110, FLJ36525, RN49018
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044037: 91%, ENSRNOG00000033921: 95%
Entrez Gene ID: 259173
Uniprot ID: Q60I27
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VDPREKLEVLERTYGEIEGTVSRVLGREYKLPMDDLLPLLIYVVSRARIQHLGAEIHLIRDMMDPNHTGGLYDFLLTALES
• Gene Sequence: VDPREKLEVLERTYGEIEGTVSRVLGREYKLPMDDLLPLLIYVVSRARIQHLGAEIHLIRDMMDPNHTGGLYDFLLTALES
• Gene ID - Mouse: ENSMUSG00000044037
• Gene ID - Rat: ENSRNOG00000033921
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.