Anti ALS2 pAb (ATL-HPA046588)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046588-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ALS2
Alternative Gene Name: ALS2CR6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026024: 91%, ENSRNOG00000023280: 91%
Entrez Gene ID: 57679
Uniprot ID: Q96Q42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSD |
| Gene Sequence | FQPGLYYSGRQDPTEGDNLPENHSGSKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELATTERRFYSKLSD |
| Gene ID - Mouse | ENSMUSG00000026024 |
| Gene ID - Rat | ENSRNOG00000023280 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALS2 pAb (ATL-HPA046588) | |
| Datasheet | Anti ALS2 pAb (ATL-HPA046588) Datasheet (External Link) |
| Vendor Page | Anti ALS2 pAb (ATL-HPA046588) at Atlas Antibodies |
| Documents & Links for Anti ALS2 pAb (ATL-HPA046588) | |
| Datasheet | Anti ALS2 pAb (ATL-HPA046588) Datasheet (External Link) |
| Vendor Page | Anti ALS2 pAb (ATL-HPA046588) |