Anti ALPP pAb (ATL-HPA038764)

Atlas Antibodies

Catalog No.:
ATL-HPA038764-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: alkaline phosphatase, placental
Gene Name: ALPP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079440: 83%, ENSRNOG00000058652: 83%
Entrez Gene ID: 250
Uniprot ID: P05187
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NWYSDADVPASARQEGCQDIATQLISNMDI
Gene Sequence NWYSDADVPASARQEGCQDIATQLISNMDI
Gene ID - Mouse ENSMUSG00000079440
Gene ID - Rat ENSRNOG00000058652
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALPP pAb (ATL-HPA038764)
Datasheet Anti ALPP pAb (ATL-HPA038764) Datasheet (External Link)
Vendor Page Anti ALPP pAb (ATL-HPA038764) at Atlas Antibodies

Documents & Links for Anti ALPP pAb (ATL-HPA038764)
Datasheet Anti ALPP pAb (ATL-HPA038764) Datasheet (External Link)
Vendor Page Anti ALPP pAb (ATL-HPA038764)
Citations for Anti ALPP pAb (ATL-HPA038764) – 1 Found
Chen, Jian; Chen, Zhilu; Liu, Mingbin; Qiu, Tianyi; Feng, Daobin; Zhao, Chen; Zhang, Shuye; Zhang, Xiaoyan; Xu, Jianqing. Placental Alkaline Phosphatase Promotes Zika Virus Replication by Stabilizing Viral Proteins through BIP. Mbio. 2020;11(5)  PubMed