Anti ALPK2 pAb (ATL-HPA029801)

Atlas Antibodies

SKU:
ATL-HPA029801-25
  • Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line BJ shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: alpha-kinase 2
Gene Name: ALPK2
Alternative Gene Name: HAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032845: 34%, ENSRNOG00000017421: 35%
Entrez Gene ID: 115701
Uniprot ID: Q86TB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEAPFTGTTTISFSNLGGVHKENASLAQHSEVKPCTCGPQHEEKQDRDGNIPDNFREDLKYEQSISEANDETMSPGVFSRHLPKDARAD
Gene Sequence EEAPFTGTTTISFSNLGGVHKENASLAQHSEVKPCTCGPQHEEKQDRDGNIPDNFREDLKYEQSISEANDETMSPGVFSRHLPKDARAD
Gene ID - Mouse ENSMUSG00000032845
Gene ID - Rat ENSRNOG00000017421
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALPK2 pAb (ATL-HPA029801)
Datasheet Anti ALPK2 pAb (ATL-HPA029801) Datasheet (External Link)
Vendor Page Anti ALPK2 pAb (ATL-HPA029801) at Atlas Antibodies

Documents & Links for Anti ALPK2 pAb (ATL-HPA029801)
Datasheet Anti ALPK2 pAb (ATL-HPA029801) Datasheet (External Link)
Vendor Page Anti ALPK2 pAb (ATL-HPA029801)