Anti ALPK1 pAb (ATL-HPA027443)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027443-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ALPK1
Alternative Gene Name: FLJ22670, KIAA1527, Lak
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028028: 94%, ENSRNOG00000022636: 93%
Entrez Gene ID: 80216
Uniprot ID: Q96QP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKAT |
Gene Sequence | LWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKAT |
Gene ID - Mouse | ENSMUSG00000028028 |
Gene ID - Rat | ENSRNOG00000022636 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALPK1 pAb (ATL-HPA027443) | |
Datasheet | Anti ALPK1 pAb (ATL-HPA027443) Datasheet (External Link) |
Vendor Page | Anti ALPK1 pAb (ATL-HPA027443) at Atlas Antibodies |
Documents & Links for Anti ALPK1 pAb (ATL-HPA027443) | |
Datasheet | Anti ALPK1 pAb (ATL-HPA027443) Datasheet (External Link) |
Vendor Page | Anti ALPK1 pAb (ATL-HPA027443) |