Anti ALPK1 pAb (ATL-HPA027443)

Atlas Antibodies

Catalog No.:
ATL-HPA027443-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: alpha-kinase 1
Gene Name: ALPK1
Alternative Gene Name: FLJ22670, KIAA1527, Lak
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028028: 94%, ENSRNOG00000022636: 93%
Entrez Gene ID: 80216
Uniprot ID: Q96QP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKAT
Gene Sequence LWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKAT
Gene ID - Mouse ENSMUSG00000028028
Gene ID - Rat ENSRNOG00000022636
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALPK1 pAb (ATL-HPA027443)
Datasheet Anti ALPK1 pAb (ATL-HPA027443) Datasheet (External Link)
Vendor Page Anti ALPK1 pAb (ATL-HPA027443) at Atlas Antibodies

Documents & Links for Anti ALPK1 pAb (ATL-HPA027443)
Datasheet Anti ALPK1 pAb (ATL-HPA027443) Datasheet (External Link)
Vendor Page Anti ALPK1 pAb (ATL-HPA027443)