Anti ALPI pAb (ATL-HPA038765)

Atlas Antibodies

SKU: ATL-HPA038765-25

• 

Protein Description: alkaline phosphatase, intestinal
Gene Name: ALPI
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026246: 79%, ENSRNOG00000042889: 79%
Entrez Gene ID: 248
Uniprot ID: P09923
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVE
• Gene Sequence: HRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVE
• Gene ID - Mouse: ENSMUSG00000026246
• Gene ID - Rat: ENSRNOG00000042889
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ALPI pAb (ATL-HPA038765) – 1 Found

Chen, Jian; Chen, Zhilu; Liu, Mingbin; Qiu, Tianyi; Feng, Daobin; Zhao, Chen; Zhang, Shuye; Zhang, Xiaoyan; Xu, Jianqing. Placental Alkaline Phosphatase Promotes Zika Virus Replication by Stabilizing Viral Proteins through BIP. Mbio. 2020;11(5)