Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026592-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ALOX5AP
Alternative Gene Name: FLAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060063: 91%, ENSRNOG00000000907: 89%
Entrez Gene ID: 241
Uniprot ID: P20292
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVL |
| Gene Sequence | HKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVL |
| Gene ID - Mouse | ENSMUSG00000060063 |
| Gene ID - Rat | ENSRNOG00000000907 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) | |
| Datasheet | Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) | |
| Datasheet | Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) |
| Citations for Anti ALOX5AP pAb (ATL-HPA026592 w/enhanced validation) – 1 Found |
| Perisic, Ljubica; Hedin, Erika; Razuvaev, Anton; Lengquist, Mariette; Osterholm, Cecilia; Folkersen, Lasse; Gillgren, Peter; Paulsson-Berne, Gabrielle; Ponten, Fredrik; Odeberg, Jacob; Hedin, Ulf. Profiling of atherosclerotic lesions by gene and tissue microarrays reveals PCSK6 as a novel protease in unstable carotid atherosclerosis. Arteriosclerosis, Thrombosis, And Vascular Biology. 2013;33(10):2432-43. PubMed |