Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA071285-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: arachidonate 5-lipoxygenase
Gene Name: ALOX5
Alternative Gene Name: 5-LOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025701: 94%, ENSRNOG00000012972: 94%
Entrez Gene ID: 240
Uniprot ID: P09917
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWY
Gene Sequence MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWY
Gene ID - Mouse ENSMUSG00000025701
Gene ID - Rat ENSRNOG00000012972
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation)
Datasheet Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation)
Datasheet Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALOX5 pAb (ATL-HPA071285 w/enhanced validation)