Anti ALOX12B pAb (ATL-HPA024002)

Atlas Antibodies

Catalog No.: ATL-HPA024002-25

Protein Description: arachidonate 12-lipoxygenase, 12R type
Gene Name: ALOX12B
Alternative Gene Name: 12R-LOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032807: 84%, ENSRNOG00000022210: 84%
Entrez Gene ID: 242
Uniprot ID: O75342
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEI
• Gene Sequence: LYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEI
• Gene ID - Mouse: ENSMUSG00000032807
• Gene ID - Rat: ENSRNOG00000022210
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.