Anti ALOX12B pAb (ATL-HPA024002)

Atlas Antibodies

Catalog No.:
ATL-HPA024002-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: arachidonate 12-lipoxygenase, 12R type
Gene Name: ALOX12B
Alternative Gene Name: 12R-LOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032807: 84%, ENSRNOG00000022210: 84%
Entrez Gene ID: 242
Uniprot ID: O75342
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEI
Gene Sequence LYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEI
Gene ID - Mouse ENSMUSG00000032807
Gene ID - Rat ENSRNOG00000022210
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALOX12B pAb (ATL-HPA024002)
Datasheet Anti ALOX12B pAb (ATL-HPA024002) Datasheet (External Link)
Vendor Page Anti ALOX12B pAb (ATL-HPA024002) at Atlas Antibodies

Documents & Links for Anti ALOX12B pAb (ATL-HPA024002)
Datasheet Anti ALOX12B pAb (ATL-HPA024002) Datasheet (External Link)
Vendor Page Anti ALOX12B pAb (ATL-HPA024002)