Anti ALOX12 pAb (ATL-HPA010691)

Atlas Antibodies

Catalog No.:
ATL-HPA010691-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: arachidonate 12-lipoxygenase
Gene Name: ALOX12
Alternative Gene Name: 12S-LOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000320: 80%, ENSRNOG00000027037: 79%
Entrez Gene ID: 239
Uniprot ID: P18054
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEY
Gene Sequence YAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEY
Gene ID - Mouse ENSMUSG00000000320
Gene ID - Rat ENSRNOG00000027037
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALOX12 pAb (ATL-HPA010691)
Datasheet Anti ALOX12 pAb (ATL-HPA010691) Datasheet (External Link)
Vendor Page Anti ALOX12 pAb (ATL-HPA010691) at Atlas Antibodies

Documents & Links for Anti ALOX12 pAb (ATL-HPA010691)
Datasheet Anti ALOX12 pAb (ATL-HPA010691) Datasheet (External Link)
Vendor Page Anti ALOX12 pAb (ATL-HPA010691)