Anti ALMS1 pAb (ATL-HPA043200 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043200-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ALMS1
Alternative Gene Name: KIAA0328
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063810: 54%, ENSRNOG00000022343: 39%
Entrez Gene ID: 7840
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DFFQHHPDKHREHMCLPLPYQNMDKTKTDYTRIKSLSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQRDQKVTP |
| Gene Sequence | DFFQHHPDKHREHMCLPLPYQNMDKTKTDYTRIKSLSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQRDQKVTP |
| Gene ID - Mouse | ENSMUSG00000063810 |
| Gene ID - Rat | ENSRNOG00000022343 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALMS1 pAb (ATL-HPA043200 w/enhanced validation) | |
| Datasheet | Anti ALMS1 pAb (ATL-HPA043200 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALMS1 pAb (ATL-HPA043200 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ALMS1 pAb (ATL-HPA043200 w/enhanced validation) | |
| Datasheet | Anti ALMS1 pAb (ATL-HPA043200 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ALMS1 pAb (ATL-HPA043200 w/enhanced validation) |