Anti ALKBH8 pAb (ATL-HPA061514)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061514-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ALKBH8
Alternative Gene Name: MGC10235
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025899: 74%, ENSRNOG00000024525: 71%
Entrez Gene ID: 91801
Uniprot ID: Q96BT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVV |
| Gene Sequence | HTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVV |
| Gene ID - Mouse | ENSMUSG00000025899 |
| Gene ID - Rat | ENSRNOG00000024525 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALKBH8 pAb (ATL-HPA061514) | |
| Datasheet | Anti ALKBH8 pAb (ATL-HPA061514) Datasheet (External Link) |
| Vendor Page | Anti ALKBH8 pAb (ATL-HPA061514) at Atlas Antibodies |
| Documents & Links for Anti ALKBH8 pAb (ATL-HPA061514) | |
| Datasheet | Anti ALKBH8 pAb (ATL-HPA061514) Datasheet (External Link) |
| Vendor Page | Anti ALKBH8 pAb (ATL-HPA061514) |
| Citations for Anti ALKBH8 pAb (ATL-HPA061514) – 1 Found |
| Brūmele, Baiba; Mutso, Margit; Telanne, Lilian; Õunap, Kadri; Spunde, Karīna; Abroi, Aare; Kurg, Reet. Human TRMT112-Methyltransferase Network Consists of Seven Partners Interacting with a Common Co-Factor. International Journal Of Molecular Sciences. 2021;22(24) PubMed |