Anti ALKBH8 pAb (ATL-HPA061514)

Atlas Antibodies

Catalog No.:
ATL-HPA061514-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: alkB, alkylation repair homolog 8 (E. coli)
Gene Name: ALKBH8
Alternative Gene Name: MGC10235
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025899: 74%, ENSRNOG00000024525: 71%
Entrez Gene ID: 91801
Uniprot ID: Q96BT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVV
Gene Sequence HTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVV
Gene ID - Mouse ENSMUSG00000025899
Gene ID - Rat ENSRNOG00000024525
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALKBH8 pAb (ATL-HPA061514)
Datasheet Anti ALKBH8 pAb (ATL-HPA061514) Datasheet (External Link)
Vendor Page Anti ALKBH8 pAb (ATL-HPA061514) at Atlas Antibodies

Documents & Links for Anti ALKBH8 pAb (ATL-HPA061514)
Datasheet Anti ALKBH8 pAb (ATL-HPA061514) Datasheet (External Link)
Vendor Page Anti ALKBH8 pAb (ATL-HPA061514)
Citations for Anti ALKBH8 pAb (ATL-HPA061514) – 1 Found
Brūmele, Baiba; Mutso, Margit; Telanne, Lilian; Õunap, Kadri; Spunde, Karīna; Abroi, Aare; Kurg, Reet. Human TRMT112-Methyltransferase Network Consists of Seven Partners Interacting with a Common Co-Factor. International Journal Of Molecular Sciences. 2021;22(24)  PubMed