Anti ALKBH8 pAb (ATL-HPA038725)

Atlas Antibodies

SKU: ATL-HPA038725-25

• 

Protein Description: alkB, alkylation repair homolog 8 (E. coli)
Gene Name: ALKBH8
Alternative Gene Name: MGC10235
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025899: 82%, ENSRNOG00000024525: 84%
Entrez Gene ID: 91801
Uniprot ID: Q96BT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPPGLMVVEEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNVDKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQG
• Gene Sequence: LPPGLMVVEEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNVDKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQG
• Gene ID - Mouse: ENSMUSG00000025899
• Gene ID - Rat: ENSRNOG00000024525
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.