Anti ALKBH8 pAb (ATL-HPA038724)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038724-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ALKBH8
Alternative Gene Name: MGC10235
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025899: 78%, ENSRNOG00000024525: 74%
Entrez Gene ID: 91801
Uniprot ID: Q96BT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKETPPSFPESDKEASRLEQEYVHQVYEEIAGHFSSTR |
Gene Sequence | TVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKETPPSFPESDKEASRLEQEYVHQVYEEIAGHFSSTR |
Gene ID - Mouse | ENSMUSG00000025899 |
Gene ID - Rat | ENSRNOG00000024525 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALKBH8 pAb (ATL-HPA038724) | |
Datasheet | Anti ALKBH8 pAb (ATL-HPA038724) Datasheet (External Link) |
Vendor Page | Anti ALKBH8 pAb (ATL-HPA038724) at Atlas Antibodies |
Documents & Links for Anti ALKBH8 pAb (ATL-HPA038724) | |
Datasheet | Anti ALKBH8 pAb (ATL-HPA038724) Datasheet (External Link) |
Vendor Page | Anti ALKBH8 pAb (ATL-HPA038724) |