Anti ALKBH7 pAb (ATL-HPA039872)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039872-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ALKBH7
Alternative Gene Name: MGC10974, SPATA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002661: 90%, ENSRNOG00000047089: 91%
Entrez Gene ID: 84266
Uniprot ID: Q9BT30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFG |
| Gene Sequence | GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFG |
| Gene ID - Mouse | ENSMUSG00000002661 |
| Gene ID - Rat | ENSRNOG00000047089 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALKBH7 pAb (ATL-HPA039872) | |
| Datasheet | Anti ALKBH7 pAb (ATL-HPA039872) Datasheet (External Link) |
| Vendor Page | Anti ALKBH7 pAb (ATL-HPA039872) at Atlas Antibodies |
| Documents & Links for Anti ALKBH7 pAb (ATL-HPA039872) | |
| Datasheet | Anti ALKBH7 pAb (ATL-HPA039872) Datasheet (External Link) |
| Vendor Page | Anti ALKBH7 pAb (ATL-HPA039872) |