Anti ALKBH7 pAb (ATL-HPA039872)

Atlas Antibodies

SKU: ATL-HPA039872-25

• 

Protein Description: alkB, alkylation repair homolog 7 (E. coli)
Gene Name: ALKBH7
Alternative Gene Name: MGC10974, SPATA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002661: 90%, ENSRNOG00000047089: 91%
Entrez Gene ID: 84266
Uniprot ID: Q9BT30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFG
• Gene Sequence: GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFG
• Gene ID - Mouse: ENSMUSG00000002661
• Gene ID - Rat: ENSRNOG00000047089
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.