Anti ALKBH7 pAb (ATL-HPA039571 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039571-25
  • Immunohistochemical staining of human Pancreas shows strong granular cytoplasmic positivity in exocrine glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ALKBH7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403154).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: alkB, alkylation repair homolog 7 (E. coli)
Gene Name: ALKBH7
Alternative Gene Name: MGC10974, SPATA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002661: 78%, ENSRNOG00000047089: 79%
Entrez Gene ID: 84266
Uniprot ID: Q9BT30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAIHGFRETEKSRWSEASRAILQRV
Gene Sequence SGPSVLSRLQDAAVVRPGFLSTAEEETLSRELEPELRRRRYEYDHWDAAIHGFRETEKSRWSEASRAILQRV
Gene ID - Mouse ENSMUSG00000002661
Gene ID - Rat ENSRNOG00000047089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ALKBH7 pAb (ATL-HPA039571 w/enhanced validation)
Datasheet Anti ALKBH7 pAb (ATL-HPA039571 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ALKBH7 pAb (ATL-HPA039571 w/enhanced validation)