Anti ALKBH7 pAb (ATL-HPA008539)
Atlas Antibodies
- SKU:
- ATL-HPA008539-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ALKBH7
Alternative Gene Name: MGC10974, SPATA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002661: 87%, ENSRNOG00000047089: 87%
Entrez Gene ID: 84266
Uniprot ID: Q9BT30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMGPGESGQPP |
Gene Sequence | GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMGPGESGQPP |
Gene ID - Mouse | ENSMUSG00000002661 |
Gene ID - Rat | ENSRNOG00000047089 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALKBH7 pAb (ATL-HPA008539) | |
Datasheet | Anti ALKBH7 pAb (ATL-HPA008539) Datasheet (External Link) |
Vendor Page | Anti ALKBH7 pAb (ATL-HPA008539) at Atlas Antibodies |
Documents & Links for Anti ALKBH7 pAb (ATL-HPA008539) | |
Datasheet | Anti ALKBH7 pAb (ATL-HPA008539) Datasheet (External Link) |
Vendor Page | Anti ALKBH7 pAb (ATL-HPA008539) |