Anti ALKBH7 pAb (ATL-HPA008539)

Atlas Antibodies

Catalog No.:
ATL-HPA008539-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: alkB homolog 7
Gene Name: ALKBH7
Alternative Gene Name: MGC10974, SPATA11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002661: 87%, ENSRNOG00000047089: 87%
Entrez Gene ID: 84266
Uniprot ID: Q9BT30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMGPGESGQPP
Gene Sequence GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGERRIPRGRRISVICRSLPEGMGPGESGQPP
Gene ID - Mouse ENSMUSG00000002661
Gene ID - Rat ENSRNOG00000047089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALKBH7 pAb (ATL-HPA008539)
Datasheet Anti ALKBH7 pAb (ATL-HPA008539) Datasheet (External Link)
Vendor Page Anti ALKBH7 pAb (ATL-HPA008539) at Atlas Antibodies

Documents & Links for Anti ALKBH7 pAb (ATL-HPA008539)
Datasheet Anti ALKBH7 pAb (ATL-HPA008539) Datasheet (External Link)
Vendor Page Anti ALKBH7 pAb (ATL-HPA008539)