Anti ALKBH6 pAb (ATL-HPA073835)

Atlas Antibodies

Catalog No.:
ATL-HPA073835-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: alkB homolog 6
Gene Name: ALKBH6
Alternative Gene Name: MGC15677
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042831: 68%, ENSRNOG00000047943: 67%
Entrez Gene ID: 84964
Uniprot ID: Q3KRA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLS
Gene Sequence GMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLS
Gene ID - Mouse ENSMUSG00000042831
Gene ID - Rat ENSRNOG00000047943
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALKBH6 pAb (ATL-HPA073835)
Datasheet Anti ALKBH6 pAb (ATL-HPA073835) Datasheet (External Link)
Vendor Page Anti ALKBH6 pAb (ATL-HPA073835) at Atlas Antibodies

Documents & Links for Anti ALKBH6 pAb (ATL-HPA073835)
Datasheet Anti ALKBH6 pAb (ATL-HPA073835) Datasheet (External Link)
Vendor Page Anti ALKBH6 pAb (ATL-HPA073835)