Anti ALKBH6 pAb (ATL-HPA073835)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073835-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ALKBH6
Alternative Gene Name: MGC15677
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042831: 68%, ENSRNOG00000047943: 67%
Entrez Gene ID: 84964
Uniprot ID: Q3KRA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLS |
Gene Sequence | GMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLS |
Gene ID - Mouse | ENSMUSG00000042831 |
Gene ID - Rat | ENSRNOG00000047943 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALKBH6 pAb (ATL-HPA073835) | |
Datasheet | Anti ALKBH6 pAb (ATL-HPA073835) Datasheet (External Link) |
Vendor Page | Anti ALKBH6 pAb (ATL-HPA073835) at Atlas Antibodies |
Documents & Links for Anti ALKBH6 pAb (ATL-HPA073835) | |
Datasheet | Anti ALKBH6 pAb (ATL-HPA073835) Datasheet (External Link) |
Vendor Page | Anti ALKBH6 pAb (ATL-HPA073835) |