Anti ALKBH4 pAb (ATL-HPA051422)

Atlas Antibodies

SKU: ATL-HPA051422-25

• 

Protein Description: alkB, alkylation repair homolog 4 (E. coli)
Gene Name: ALKBH4
Alternative Gene Name: FLJ20013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039754: 79%, ENSRNOG00000001428: 79%
Entrez Gene ID: 54784
Uniprot ID: Q9NXW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVN
• Gene Sequence: TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVN
• Gene ID - Mouse: ENSMUSG00000039754
• Gene ID - Rat: ENSRNOG00000001428
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.