Anti ALKBH4 pAb (ATL-HPA051422)
Atlas Antibodies
- SKU:
- ATL-HPA051422-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ALKBH4
Alternative Gene Name: FLJ20013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039754: 79%, ENSRNOG00000001428: 79%
Entrez Gene ID: 54784
Uniprot ID: Q9NXW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVN |
Gene Sequence | TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVN |
Gene ID - Mouse | ENSMUSG00000039754 |
Gene ID - Rat | ENSRNOG00000001428 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALKBH4 pAb (ATL-HPA051422) | |
Datasheet | Anti ALKBH4 pAb (ATL-HPA051422) Datasheet (External Link) |
Vendor Page | Anti ALKBH4 pAb (ATL-HPA051422) at Atlas Antibodies |
Documents & Links for Anti ALKBH4 pAb (ATL-HPA051422) | |
Datasheet | Anti ALKBH4 pAb (ATL-HPA051422) Datasheet (External Link) |
Vendor Page | Anti ALKBH4 pAb (ATL-HPA051422) |