Anti ALKBH4 pAb (ATL-HPA051422)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051422-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ALKBH4
Alternative Gene Name: FLJ20013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039754: 79%, ENSRNOG00000001428: 79%
Entrez Gene ID: 54784
Uniprot ID: Q9NXW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVN |
| Gene Sequence | TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVN |
| Gene ID - Mouse | ENSMUSG00000039754 |
| Gene ID - Rat | ENSRNOG00000001428 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALKBH4 pAb (ATL-HPA051422) | |
| Datasheet | Anti ALKBH4 pAb (ATL-HPA051422) Datasheet (External Link) |
| Vendor Page | Anti ALKBH4 pAb (ATL-HPA051422) at Atlas Antibodies |
| Documents & Links for Anti ALKBH4 pAb (ATL-HPA051422) | |
| Datasheet | Anti ALKBH4 pAb (ATL-HPA051422) Datasheet (External Link) |
| Vendor Page | Anti ALKBH4 pAb (ATL-HPA051422) |