Anti ALKBH4 pAb (ATL-HPA051422)

Atlas Antibodies

Catalog No.:
ATL-HPA051422-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: alkB, alkylation repair homolog 4 (E. coli)
Gene Name: ALKBH4
Alternative Gene Name: FLJ20013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039754: 79%, ENSRNOG00000001428: 79%
Entrez Gene ID: 54784
Uniprot ID: Q9NXW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVN
Gene Sequence TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVN
Gene ID - Mouse ENSMUSG00000039754
Gene ID - Rat ENSRNOG00000001428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALKBH4 pAb (ATL-HPA051422)
Datasheet Anti ALKBH4 pAb (ATL-HPA051422) Datasheet (External Link)
Vendor Page Anti ALKBH4 pAb (ATL-HPA051422) at Atlas Antibodies

Documents & Links for Anti ALKBH4 pAb (ATL-HPA051422)
Datasheet Anti ALKBH4 pAb (ATL-HPA051422) Datasheet (External Link)
Vendor Page Anti ALKBH4 pAb (ATL-HPA051422)