Anti ALKBH3 pAb (ATL-HPA046489)

Atlas Antibodies

Catalog No.:
ATL-HPA046489-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: alkB homolog 3, alpha-ketoglutarate-dependent dioxygenase
Gene Name: ALKBH3
Alternative Gene Name: DEPC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040174: 93%, ENSRNOG00000021678: 94%
Entrez Gene ID: 221120
Uniprot ID: Q96Q83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEY
Gene Sequence NPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEY
Gene ID - Mouse ENSMUSG00000040174
Gene ID - Rat ENSRNOG00000021678
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALKBH3 pAb (ATL-HPA046489)
Datasheet Anti ALKBH3 pAb (ATL-HPA046489) Datasheet (External Link)
Vendor Page Anti ALKBH3 pAb (ATL-HPA046489) at Atlas Antibodies

Documents & Links for Anti ALKBH3 pAb (ATL-HPA046489)
Datasheet Anti ALKBH3 pAb (ATL-HPA046489) Datasheet (External Link)
Vendor Page Anti ALKBH3 pAb (ATL-HPA046489)