Anti ALKBH3 pAb (ATL-HPA046489)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046489-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ALKBH3
Alternative Gene Name: DEPC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040174: 93%, ENSRNOG00000021678: 94%
Entrez Gene ID: 221120
Uniprot ID: Q96Q83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEY |
Gene Sequence | NPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEY |
Gene ID - Mouse | ENSMUSG00000040174 |
Gene ID - Rat | ENSRNOG00000021678 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALKBH3 pAb (ATL-HPA046489) | |
Datasheet | Anti ALKBH3 pAb (ATL-HPA046489) Datasheet (External Link) |
Vendor Page | Anti ALKBH3 pAb (ATL-HPA046489) at Atlas Antibodies |
Documents & Links for Anti ALKBH3 pAb (ATL-HPA046489) | |
Datasheet | Anti ALKBH3 pAb (ATL-HPA046489) Datasheet (External Link) |
Vendor Page | Anti ALKBH3 pAb (ATL-HPA046489) |