Anti ALKBH2 pAb (ATL-HPA045392)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045392-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ALKBH2
Alternative Gene Name: ABH2, MGC90512
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044339: 89%, ENSRNOG00000028584: 88%
Entrez Gene ID: 121642
Uniprot ID: Q6NS38
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK |
Gene Sequence | DDERELAPGSPIASVSFGACRDFVFRHKDSRGKSPSRRVAVVRLPLAHGSLLMMNHPTNTHWYHSLPVRKKVLAPRVNLTFRK |
Gene ID - Mouse | ENSMUSG00000044339 |
Gene ID - Rat | ENSRNOG00000028584 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALKBH2 pAb (ATL-HPA045392) | |
Datasheet | Anti ALKBH2 pAb (ATL-HPA045392) Datasheet (External Link) |
Vendor Page | Anti ALKBH2 pAb (ATL-HPA045392) at Atlas Antibodies |
Documents & Links for Anti ALKBH2 pAb (ATL-HPA045392) | |
Datasheet | Anti ALKBH2 pAb (ATL-HPA045392) Datasheet (External Link) |
Vendor Page | Anti ALKBH2 pAb (ATL-HPA045392) |