Anti ALKBH1 pAb (ATL-HPA060061)

Atlas Antibodies

SKU: ATL-HPA060061-25

• 

Protein Description: alkB homolog 1, histone H2A dioxygenase
Gene Name: ALKBH1
Alternative Gene Name: ABH, alkB, ALKBH, hABH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079036: 80%, ENSRNOG00000012264: 83%
Entrez Gene ID: 8846
Uniprot ID: Q13686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLD
• Gene Sequence: IKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLD
• Gene ID - Mouse: ENSMUSG00000079036
• Gene ID - Rat: ENSRNOG00000012264
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.