Anti ALKBH1 pAb (ATL-HPA060061)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060061-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ALKBH1
Alternative Gene Name: ABH, alkB, ALKBH, hABH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079036: 80%, ENSRNOG00000012264: 83%
Entrez Gene ID: 8846
Uniprot ID: Q13686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLD |
| Gene Sequence | IKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLD |
| Gene ID - Mouse | ENSMUSG00000079036 |
| Gene ID - Rat | ENSRNOG00000012264 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ALKBH1 pAb (ATL-HPA060061) | |
| Datasheet | Anti ALKBH1 pAb (ATL-HPA060061) Datasheet (External Link) |
| Vendor Page | Anti ALKBH1 pAb (ATL-HPA060061) at Atlas Antibodies |
| Documents & Links for Anti ALKBH1 pAb (ATL-HPA060061) | |
| Datasheet | Anti ALKBH1 pAb (ATL-HPA060061) Datasheet (External Link) |
| Vendor Page | Anti ALKBH1 pAb (ATL-HPA060061) |