Anti ALKBH1 pAb (ATL-HPA044087)

Atlas Antibodies

SKU: ATL-HPA044087-25

• 
• 

Protein Description: alkB, alkylation repair homolog 1 (E. coli)
Gene Name: ALKBH1
Alternative Gene Name: ABH, alkB, ALKBH, hABH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079036: 74%, ENSRNOG00000012264: 74%
Entrez Gene ID: 8846
Uniprot ID: Q13686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN
• Gene Sequence: SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN
• Gene ID - Mouse: ENSMUSG00000079036
• Gene ID - Rat: ENSRNOG00000012264
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ALKBH1 pAb (ATL-HPA044087) – 1 Found

Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759.