Anti ALKBH1 pAb (ATL-HPA044087)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044087-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ALKBH1
Alternative Gene Name: ABH, alkB, ALKBH, hABH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079036: 74%, ENSRNOG00000012264: 74%
Entrez Gene ID: 8846
Uniprot ID: Q13686
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN |
Gene Sequence | SMVEPCSLEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARIN |
Gene ID - Mouse | ENSMUSG00000079036 |
Gene ID - Rat | ENSRNOG00000012264 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALKBH1 pAb (ATL-HPA044087) | |
Datasheet | Anti ALKBH1 pAb (ATL-HPA044087) Datasheet (External Link) |
Vendor Page | Anti ALKBH1 pAb (ATL-HPA044087) at Atlas Antibodies |
Documents & Links for Anti ALKBH1 pAb (ATL-HPA044087) | |
Datasheet | Anti ALKBH1 pAb (ATL-HPA044087) Datasheet (External Link) |
Vendor Page | Anti ALKBH1 pAb (ATL-HPA044087) |
Citations for Anti ALKBH1 pAb (ATL-HPA044087) – 1 Found |
Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759. PubMed |