Anti ALK pAb (ATL-HPA010694)
Atlas Antibodies
- SKU:
- ATL-HPA010694-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: ALK
Alternative Gene Name: CD246
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055471: 84%, ENSRNOG00000008683: 83%
Entrez Gene ID: 238
Uniprot ID: Q9UM73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILS |
Gene Sequence | IFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILS |
Gene ID - Mouse | ENSMUSG00000055471 |
Gene ID - Rat | ENSRNOG00000008683 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALK pAb (ATL-HPA010694) | |
Datasheet | Anti ALK pAb (ATL-HPA010694) Datasheet (External Link) |
Vendor Page | Anti ALK pAb (ATL-HPA010694) at Atlas Antibodies |
Documents & Links for Anti ALK pAb (ATL-HPA010694) | |
Datasheet | Anti ALK pAb (ATL-HPA010694) Datasheet (External Link) |
Vendor Page | Anti ALK pAb (ATL-HPA010694) |