Anti ALK pAb (ATL-HPA010694)

Atlas Antibodies

SKU:
ATL-HPA010694-25
  • Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in neurons.
  • Immunofluorescent staining of human cell line RH-30 shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: anaplastic lymphoma receptor tyrosine kinase
Gene Name: ALK
Alternative Gene Name: CD246
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055471: 84%, ENSRNOG00000008683: 83%
Entrez Gene ID: 238
Uniprot ID: Q9UM73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILS
Gene Sequence IFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILS
Gene ID - Mouse ENSMUSG00000055471
Gene ID - Rat ENSRNOG00000008683
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALK pAb (ATL-HPA010694)
Datasheet Anti ALK pAb (ATL-HPA010694) Datasheet (External Link)
Vendor Page Anti ALK pAb (ATL-HPA010694) at Atlas Antibodies

Documents & Links for Anti ALK pAb (ATL-HPA010694)
Datasheet Anti ALK pAb (ATL-HPA010694) Datasheet (External Link)
Vendor Page Anti ALK pAb (ATL-HPA010694)