Anti ALG6 pAb (ATL-HPA062536)

Atlas Antibodies

Catalog No.:
ATL-HPA062536-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ALG6, alpha-1,3-glucosyltransferase
Gene Name: ALG6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073792: 86%, ENSRNOG00000009045: 67%
Entrez Gene ID: 29929
Uniprot ID: Q9Y672
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTEREQTLQVLRRLFPVDRGLFEDKVANIWCSFNVFLKIKDI
Gene Sequence FTEREQTLQVLRRLFPVDRGLFEDKVANIWCSFNVFLKIKDI
Gene ID - Mouse ENSMUSG00000073792
Gene ID - Rat ENSRNOG00000009045
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALG6 pAb (ATL-HPA062536)
Datasheet Anti ALG6 pAb (ATL-HPA062536) Datasheet (External Link)
Vendor Page Anti ALG6 pAb (ATL-HPA062536) at Atlas Antibodies

Documents & Links for Anti ALG6 pAb (ATL-HPA062536)
Datasheet Anti ALG6 pAb (ATL-HPA062536) Datasheet (External Link)
Vendor Page Anti ALG6 pAb (ATL-HPA062536)