Anti ALG5 pAb (ATL-HPA007989)

Atlas Antibodies

SKU:
ATL-HPA007989-100
  • Immunohistochemical staining of human rectum shows cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ALG5, dolichyl-phosphate beta-glucosyltransferase
Gene Name: ALG5
Alternative Gene Name: bA421P11.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036632: 92%, ENSRNOG00000058694: 92%
Entrez Gene ID: 29880
Uniprot ID: Q9Y673
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen RHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDL
Gene Sequence RHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDL
Gene ID - Mouse ENSMUSG00000036632
Gene ID - Rat ENSRNOG00000058694
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALG5 pAb (ATL-HPA007989)
Datasheet Anti ALG5 pAb (ATL-HPA007989) Datasheet (External Link)
Vendor Page Anti ALG5 pAb (ATL-HPA007989) at Atlas Antibodies

Documents & Links for Anti ALG5 pAb (ATL-HPA007989)
Datasheet Anti ALG5 pAb (ATL-HPA007989) Datasheet (External Link)
Vendor Page Anti ALG5 pAb (ATL-HPA007989)