Anti ALG3 pAb (ATL-HPA045103)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045103-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ALG3
Alternative Gene Name: CDGS4, D16Ertd36e, Not56, NOT56L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033809: 87%, ENSRNOG00000001712: 89%
Entrez Gene ID: 10195
Uniprot ID: Q92685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR |
Gene Sequence | IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR |
Gene ID - Mouse | ENSMUSG00000033809 |
Gene ID - Rat | ENSRNOG00000001712 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ALG3 pAb (ATL-HPA045103) | |
Datasheet | Anti ALG3 pAb (ATL-HPA045103) Datasheet (External Link) |
Vendor Page | Anti ALG3 pAb (ATL-HPA045103) at Atlas Antibodies |
Documents & Links for Anti ALG3 pAb (ATL-HPA045103) | |
Datasheet | Anti ALG3 pAb (ATL-HPA045103) Datasheet (External Link) |
Vendor Page | Anti ALG3 pAb (ATL-HPA045103) |