Anti ALG3 pAb (ATL-HPA045103)

Atlas Antibodies

Catalog No.:
ATL-HPA045103-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ALG3, alpha-1,3- mannosyltransferase
Gene Name: ALG3
Alternative Gene Name: CDGS4, D16Ertd36e, Not56, NOT56L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033809: 87%, ENSRNOG00000001712: 89%
Entrez Gene ID: 10195
Uniprot ID: Q92685
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR
Gene Sequence IDWKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIR
Gene ID - Mouse ENSMUSG00000033809
Gene ID - Rat ENSRNOG00000001712
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ALG3 pAb (ATL-HPA045103)
Datasheet Anti ALG3 pAb (ATL-HPA045103) Datasheet (External Link)
Vendor Page Anti ALG3 pAb (ATL-HPA045103) at Atlas Antibodies

Documents & Links for Anti ALG3 pAb (ATL-HPA045103)
Datasheet Anti ALG3 pAb (ATL-HPA045103) Datasheet (External Link)
Vendor Page Anti ALG3 pAb (ATL-HPA045103)