Anti ALG1L pAb (ATL-HPA036108)

Atlas Antibodies

SKU:
ATL-HPA036108-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Sertoli and Leydig cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase-like
Gene Name: ALG1L
Alternative Gene Name: ALG1L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021061: 33%, ENSRNOG00000008401: 31%
Entrez Gene ID: 200810
Uniprot ID: Q6GMV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLPLVMDIQLLGQRLKPRDPCCPSRSFFSESQGKPF
Gene Sequence VLPLVMDIQLLGQRLKPRDPCCPSRSFFSESQGKPF
Gene ID - Mouse ENSMUSG00000021061
Gene ID - Rat ENSRNOG00000008401
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALG1L pAb (ATL-HPA036108)
Datasheet Anti ALG1L pAb (ATL-HPA036108) Datasheet (External Link)
Vendor Page Anti ALG1L pAb (ATL-HPA036108) at Atlas Antibodies

Documents & Links for Anti ALG1L pAb (ATL-HPA036108)
Datasheet Anti ALG1L pAb (ATL-HPA036108) Datasheet (External Link)
Vendor Page Anti ALG1L pAb (ATL-HPA036108)