Anti ALG14 pAb (ATL-HPA031829)

Atlas Antibodies

SKU:
ATL-HPA031829-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ALG14, UDP-N-acetylglucosaminyltransferase subunit
Gene Name: ALG14
Alternative Gene Name: MGC19780
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039887: 73%, ENSRNOG00000011528: 72%
Entrez Gene ID: 199857
Uniprot ID: Q96F25
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLSILVVAGSGGHTTEILRLLGSLSNAYSPRHYVIADTDEMSANKINSFELDRADRDPSNMYTKYYIHRIPRSR
Gene Sequence SLSILVVAGSGGHTTEILRLLGSLSNAYSPRHYVIADTDEMSANKINSFELDRADRDPSNMYTKYYIHRIPRSR
Gene ID - Mouse ENSMUSG00000039887
Gene ID - Rat ENSRNOG00000011528
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ALG14 pAb (ATL-HPA031829)
Datasheet Anti ALG14 pAb (ATL-HPA031829) Datasheet (External Link)
Vendor Page Anti ALG14 pAb (ATL-HPA031829) at Atlas Antibodies

Documents & Links for Anti ALG14 pAb (ATL-HPA031829)
Datasheet Anti ALG14 pAb (ATL-HPA031829) Datasheet (External Link)
Vendor Page Anti ALG14 pAb (ATL-HPA031829)