Anti ALG10 pAb (ATL-HPA043329)

Atlas Antibodies

Catalog No.: ATL-HPA043329-100

Protein Description: ALG10, alpha-1,2-glucosyltransferase
Gene Name: ALG10
Alternative Gene Name: ALG10A, DIE2, FLJ14751
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075470: 97%, ENSRNOG00000014511: 97%
Entrez Gene ID: 84920
Uniprot ID: Q5BKT4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLP
• Gene Sequence: SRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLP
• Gene ID - Mouse: ENSMUSG00000075470
• Gene ID - Rat: ENSRNOG00000014511
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.